SCOPe 2.03: Domain d3cd4a2: 3cd4 A:98-178

Lineage for d3cd4a2 (3cd4 A:98-178)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49150] (29 PDB entries)

8. Domain d3cd4a2: 3cd4 A:98-178 [21659]
   Other proteins in same PDB: d3cd4a1
   domain 2

Details for d3cd4a2

PDB Entry: 3cd4, 2.2 Å

PDB Description: refinement and analysis of the first two domains of human cd4

PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d3cd4a2:

Sequence; same for both SEQRES and ATOM records:

>d3cd4a2 b.1.1.3 (A:98-178) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidivvla

Timeline for d3cd4a2:

• d3cd4a2 first appeared (with stable ids) in SCOP 1.55, called d3cd4_2
  
• d3cd4a2 appears in SCOPe 2.02
  
• d3cd4a2 appears in SCOPe 2.04
  
• d3cd4a2 appears in the current release, SCOPe 2.08