Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein CD4 C2-set domains [49149] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49150] (15 PDB entries) |
Domain d3cd4_2: 3cd4 98-178 [21659] Other proteins in same PDB: d3cd4_1 domain 2 |
PDB Entry: 3cd4 (more details), 2.2 Å
SCOP Domain Sequences for d3cd4_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cd4_2 b.1.1.3 (98-178) CD4 C2-set domains {Human (Homo sapiens)} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivvla
Timeline for d3cd4_2: