SCOPe 2.08: Domain d3swoa2: 3swo A:244-396

Lineage for d3swoa2 (3swo A:244-396)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries)

8. Domain d3swoa2: 3swo A:244-396 [216589]
   Other proteins in same PDB: d3swoa1, d3swob1, d3swoc1, d3swod1
   automated match to d1siqa1
   complexed with edo, fda, unx

Details for d3swoa2

PDB Entry: 3swo, 1.45 Å

PDB Description: crystal structure of a glutaryl-coa dehydrogenase from mycobacterium smegmatis in complex with fadh2

PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3swoa2:

Sequence; same for both SEQRES and ATOM records:

>d3swoa2 a.29.3.0 (A:244-396) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
lsaplsclnearfgivfgalgaardslettiaytqsrevfdkplsnyqltqeklanmtve
lgkgmllaihlgrikdaegvrpeqislgklnnvreaiaiarecrtllggsgitleysplr
hannlesvltyegtsemhllsigkaltgkaafr

Timeline for d3swoa2:

• d3swoa2 first appeared in SCOPe 2.03
  
• d3swoa2 appears in SCOPe 2.07