![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein Intercellular cell adhesion molecule-2 (ICAM-2) [49147] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49148] (1 PDB entry) |
![]() | Domain d1zxqa1: 1zxq A:87-192 [21657] Other proteins in same PDB: d1zxqa2 D2 |
PDB Entry: 1zxq (more details), 2.2 Å
SCOPe Domain Sequences for d1zxqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} pprqviltlqptlvavgksftiecrvptvepldsltlflfrgnetlhyetfgkaapapqe atatfnstadredghrnfsclavldlmsrggnifhkhsapkmleiy
Timeline for d1zxqa1: