Lineage for d1ic1a1 (1ic1 A:83-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753531Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 2753532Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 2753535Domain d1ic1a1: 1ic1 A:83-190 [21654]
    Other proteins in same PDB: d1ic1a2, d1ic1b2
    D2
    complexed with nag

Details for d1ic1a1

PDB Entry: 1ic1 (more details), 3 Å

PDB Description: the crystal structure for the n-terminal two domains of icam-1
PDB Compounds: (A:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1ic1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic1a1 b.1.1.3 (A:83-190) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvlpat

SCOPe Domain Coordinates for d1ic1a1:

Click to download the PDB-style file with coordinates for d1ic1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ic1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ic1a2