SCOPe 2.06: Domain d3ss6b1: 3ss6 B:1-268

Lineage for d3ss6b1 (3ss6 B:1-268)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [226176] (1 PDB entry)

8. Domain d3ss6b1: 3ss6 B:1-268 [216534]
   Other proteins in same PDB: d3ss6a3, d3ss6b3
   automated match to d1ulqa1
   complexed with k, so4

Details for d3ss6b1

PDB Entry: 3ss6, 1.7 Å

PDB Description: Crystal structure of the Bacillus anthracis acetyl-CoA acetyltransferase

PDB Compounds: (B:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d3ss6b1:

Sequence; same for both SEQRES and ATOM records:

>d3ss6b1 c.95.1.0 (B:1-268) automated matches {Bacillus anthracis [TaxId: 261594]}
mhnvvitaavrspigtfggalknvtpvelavpvlqeavkrggvephevdevilghciqrt
deantartaalaagfpdtvtgytiqrqcssgmqaimsaamqiqlgvsevvvaggveamss
spyalkqhrwgqrlqhgeirdtvwevledpihhimmgetaenlveqyeitreeqdevalr
shtlalkaiesgyfddqivpitikerrkevvfskdehpraditaeklaglkpafrkdgsv
tagnasglndgsavlvlmseekakekgl

Timeline for d3ss6b1:

• d3ss6b1 first appeared in SCOPe 2.03
  
• d3ss6b1 appears in SCOPe 2.05
  
• d3ss6b1 appears in SCOPe 2.07
  
• d3ss6b1 appears in the current release, SCOPe 2.08