Lineage for d3ss6a1 (3ss6 A:1-268)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165241Species Bacillus anthracis [TaxId:261594] [226176] (1 PDB entry)
  8. 2165242Domain d3ss6a1: 3ss6 A:1-268 [216532]
    Other proteins in same PDB: d3ss6a3, d3ss6b3
    automated match to d1ulqa1
    complexed with k, so4

Details for d3ss6a1

PDB Entry: 3ss6 (more details), 1.7 Å

PDB Description: Crystal structure of the Bacillus anthracis acetyl-CoA acetyltransferase
PDB Compounds: (A:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d3ss6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ss6a1 c.95.1.0 (A:1-268) automated matches {Bacillus anthracis [TaxId: 261594]}
mhnvvitaavrspigtfggalknvtpvelavpvlqeavkrggvephevdevilghciqrt
deantartaalaagfpdtvtgytiqrqcssgmqaimsaamqiqlgvsevvvaggveamss
spyalkqhrwgqrlqhgeirdtvwevledpihhimmgetaenlveqyeitreeqdevalr
shtlalkaiesgyfddqivpitikerrkevvfskdehpraditaeklaglkpafrkdgsv
tagnasglndgsavlvlmseekakekgl

SCOPe Domain Coordinates for d3ss6a1:

Click to download the PDB-style file with coordinates for d3ss6a1.
(The format of our PDB-style files is described here.)

Timeline for d3ss6a1: