SCOPe 2.08: Domain d3srta1: 3srt A:1-185

Lineage for d3srta1 (3srt A:1-185)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [193268] (4 PDB entries)

8. Domain d3srta1: 3srt A:1-185 [216528]
   Other proteins in same PDB: d3srta2, d3srtb2
   automated match to d4isxa_
   complexed with gol

Details for d3srta1

PDB Entry: 3srt, 2.5 Å

PDB Description: The crystal structure of a maltose O-acetyltransferase from Clostridium difficile 630

PDB Compounds: (A:) maltose o-acetyltransferase

SCOPe Domain Sequences for d3srta1:

Sequence; same for both SEQRES and ATOM records:

>d3srta1 b.81.1.0 (A:1-185) automated matches {Clostridium difficile [TaxId: 272563]}
mtekekmlsgkgyyandellvkereyckkltrlfnntledeyekredilrqlfgsvgkqi
nveqnircdygynihvgenffanydcifldvckieigdnvmlapnvqiytayhpidaqlr
nsgieygspvkigdnvwigggviitpgitigdnvvigagsvvtkdippntvavgnpcrvi
kkiee

Timeline for d3srta1:

• d3srta1 first appeared in SCOPe 2.03, called d3srta_
  
• d3srta1 appears in SCOPe 2.07