Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (40 species) not a true protein |
Species Streptococcus mutans [TaxId:1309] [226414] (1 PDB entry) |
Domain d3sqza2: 3sqz A:168-388 [216520] automated match to d1xpma2 complexed with coa, gol |
PDB Entry: 3sqz (more details), 1.2 Å
SCOPe Domain Sequences for d3sqza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sqza2 c.95.1.0 (A:168-388) automated matches {Streptococcus mutans [TaxId: 1309]} ililhdetlaqtrdimdfwrpnytttpyvngmystkqyldmlkttwaeyqkrfdvsltdf aafcfhlpfpklalkgfnkimdkqvpsdlqeklkvnfeasilyskqigniytgslflgll sllensqnlvagdkialfsygsgavaeiftgtlvkgfkeqlqtnrldklkrrtplsveny ekiffeeaqlddkgnasfkeyqtgpfalkeilehqriygkv
Timeline for d3sqza2: