Lineage for d3sqza2 (3sqz A:168-388)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393151Species Streptococcus mutans [TaxId:1309] [226414] (1 PDB entry)
  8. 1393153Domain d3sqza2: 3sqz A:168-388 [216520]
    automated match to d1xpma2
    complexed with coa, gol

Details for d3sqza2

PDB Entry: 3sqz (more details), 1.2 Å

PDB Description: Crystal structure of HMG_CoA synthase complexed with CoA
PDB Compounds: (A:) Putative hydroxymethylglutaryl-CoA synthase

SCOPe Domain Sequences for d3sqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqza2 c.95.1.0 (A:168-388) automated matches {Streptococcus mutans [TaxId: 1309]}
ililhdetlaqtrdimdfwrpnytttpyvngmystkqyldmlkttwaeyqkrfdvsltdf
aafcfhlpfpklalkgfnkimdkqvpsdlqeklkvnfeasilyskqigniytgslflgll
sllensqnlvagdkialfsygsgavaeiftgtlvkgfkeqlqtnrldklkrrtplsveny
ekiffeeaqlddkgnasfkeyqtgpfalkeilehqriygkv

SCOPe Domain Coordinates for d3sqza2:

Click to download the PDB-style file with coordinates for d3sqza2.
(The format of our PDB-style files is described here.)

Timeline for d3sqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sqza1