SCOP 1.75: Domain d1vscb1: 1vsc B:91-196

Lineage for d1vscb1 (1vsc B:91-196)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)

8. Domain d1vscb1: 1vsc B:91-196 [21652]
   Other proteins in same PDB: d1vsca2, d1vscb2
   D2
   mutant

Details for d1vscb1

PDB Entry: 1vsc, 1.9 Å

PDB Description: vcam-1

PDB Compounds: (B:) vascular cell adhesion molecule-1

SCOP Domain Sequences for d1vscb1:

Sequence; same for both SEQRES and ATOM records:

>d1vscb1 b.1.1.3 (B:91-196) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvd

Timeline for d1vscb1:

• d1vscb1 first appeared (with stable ids) in SCOP 1.55
  
• d1vscb1 appears in SCOP 1.73
  
• d1vscb1 appears in SCOPe 2.01
  
• d1vscb1 appears in the current release, SCOPe 2.08