SCOPe 2.03: Domain d3sqza1: 3sqz A:1-167

Lineage for d3sqza1 (3sqz A:1-167)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [226414] (1 PDB entry)

8. Domain d3sqza1: 3sqz A:1-167 [216519]
   automated match to d1tvza1
   complexed with coa, gol

Details for d3sqza1

PDB Entry: 3sqz, 1.2 Å

PDB Description: Crystal structure of HMG_CoA synthase complexed with CoA

PDB Compounds: (A:) Putative hydroxymethylglutaryl-CoA synthase

SCOPe Domain Sequences for d3sqza1:

Sequence; same for both SEQRES and ATOM records:

>d3sqza1 c.95.1.0 (A:1-167) automated matches {Streptococcus mutans [TaxId: 1309]}
mrigidkigftssqyvlnmkdlaeargedpqkfskglllnalsiapitddvvtlaagsan
eiltaedkekidmvilatessvdqskagavyvhsllgiqpfarsfemkeacysataalny
aklhvekhpdtrvlvlasdiakygigtpgestqgagsiamlvkkdpr

Timeline for d3sqza1:

• d3sqza1 is new in SCOPe 2.03-stable
  
• d3sqza1 appears in SCOPe 2.04
  
• d3sqza1 appears in the current release, SCOPe 2.08