Lineage for d3sqgh2 (3sqg H:184-433)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719743Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2719744Protein automated matches [227075] (6 species)
    not a true protein
  7. 2719767Species Uncultured archaeon [TaxId:115547] [226263] (1 PDB entry)
  8. 2719773Domain d3sqgh2: 3sqg H:184-433 [216515]
    Other proteins in same PDB: d3sqga1, d3sqgb1, d3sqgd1, d3sqge1, d3sqgg1, d3sqgh1
    automated match to d1e6vb1
    complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7

Details for d3sqgh2

PDB Entry: 3sqg (more details), 2.1 Å

PDB Description: crystal structure of a methyl-coenzyme m reductase purified from black sea mats
PDB Compounds: (H:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d3sqgh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqgh2 a.89.1.0 (H:184-433) automated matches {Uncultured archaeon [TaxId: 115547]}
gftlrnipvnhlaatvrkramqgagltmileeaaqfemgncmgpherghlldlayeglna
nnllyslikdngqdgslgdviyaavekakadgvikslkkmpsgftvydaddmqlwnayac
tamlagvcvncasmragqpvpgnimqacclieretglpgpdfgmaqgasvsssffshsiy
ggggpgvfygnhivtrhakgqfipcfcaamcidadtmyfspartsalygevlgaipefae
pmravaeaak

SCOPe Domain Coordinates for d3sqgh2:

Click to download the PDB-style file with coordinates for d3sqgh2.
(The format of our PDB-style files is described here.)

Timeline for d3sqgh2: