Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
Protein automated matches [227074] (6 species) not a true protein |
Species Uncultured archaeon [TaxId:115547] [226262] (1 PDB entry) |
Domain d3sqgh1: 3sqg H:3-183 [216514] Other proteins in same PDB: d3sqga2, d3sqgb2, d3sqgd2, d3sqge2, d3sqgg2, d3sqgh2 automated match to d1e6vb2 complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7 |
PDB Entry: 3sqg (more details), 2.1 Å
SCOPe Domain Sequences for d3sqgh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sqgh1 d.58.31.0 (H:3-183) automated matches {Uncultured archaeon [TaxId: 115547]} deidlyddkgkklaagvplqnisplknaaikkivnltirtgavdlaglekkfatgaiagr gmvirgvnrnlpivdkakeiakavedmlrvesgddtnveliaggkrmmvqpptarilsdy svgltasmgalthaiidvcnvsmwdapyvhagvwgmypqnpdpgdgavkmlvdipmkneg p
Timeline for d3sqgh1: