Class a: All alpha proteins [46456] (290 folds) |
Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) multihelical bundle; contains buried central helix |
Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) |
Family a.89.1.0: automated matches [227272] (1 protein) not a true family |
Protein automated matches [227075] (6 species) not a true protein |
Species Uncultured archaeon [TaxId:115547] [226263] (1 PDB entry) |
Domain d3sqgg2: 3sqg G:284-579 [216513] Other proteins in same PDB: d3sqga1, d3sqgb1, d3sqgd1, d3sqge1, d3sqgg1, d3sqgh1 automated match to d1e6ya1 complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7 |
PDB Entry: 3sqg (more details), 2.1 Å
SCOPe Domain Sequences for d3sqgg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sqgg2 a.89.1.0 (G:284-579) automated matches {Uncultured archaeon [TaxId: 115547]} krarshnepggmplginadstrspalfpndpiraelesiavaamvydqlwfgtymsggvg ftqyasatytdniledfcykgceigldyaggkmasikgdklnmdileeiiraendyaltq yeayptvaeshfggsvraccaaagcgsavacatglaqpalsawslsmlghyervgrlgff gydlqdqctacgsysyqsdegmpfemrgvnypnyamnvghqsayaglvagahsanhdawv lsplwkvafsdrdlpfdrgyvtreyglganreytkvagerdliiaghygrepgakl
Timeline for d3sqgg2: