Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.3: C2 set domains [49142] (8 proteins) |
Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries) |
Domain d1vsca1: 1vsc A:91-195 [21651] Other proteins in same PDB: d1vsca2, d1vsca3, d1vscb2, d1vscb3 D2 |
PDB Entry: 1vsc (more details), 1.9 Å
SCOPe Domain Sequences for d1vsca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsca1 b.1.1.3 (A:91-195) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqv
Timeline for d1vsca1: