SCOP 1.57: Domain d1vcab1: 1vca B:91-199

Lineage for d1vcab1 (1vca B:91-199)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Second domain of vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)

8. Domain d1vcab1: 1vca B:91-199 [21650]
   Other proteins in same PDB: d1vcaa2, d1vcab2

Details for d1vcab1

PDB Entry: 1vca, 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution

SCOP Domain Sequences for d1vcab1:

Sequence; same for both SEQRES and ATOM records:

>d1vcab1 b.1.1.3 (B:91-199) Second domain of vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvyisp

Timeline for d1vcab1:

• d1vcab1 first appeared (with stable ids) in SCOP 1.55
  
• d1vcab1 appears in SCOP 1.59
  
• d1vcab1 appears in the current release, SCOPe 2.08