Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.3: C2 set domains [49142] (7 proteins) |
Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries) |
Domain d1vcaa1: 1vca A:91-199 [21649] Other proteins in same PDB: d1vcaa2, d1vcab2 |
PDB Entry: 1vca (more details), 1.8 Å
SCOP Domain Sequences for d1vcaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)} fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvyisp
Timeline for d1vcaa1: