SCOP 1.71: Domain d1vcaa1: 1vca A:91-199

Lineage for d1vcaa1 (1vca A:91-199)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)

8. Domain d1vcaa1: 1vca A:91-199 [21649]
   Other proteins in same PDB: d1vcaa2, d1vcab2

Details for d1vcaa1

PDB Entry: 1vca, 1.8 Å

PDB Description: crystal structure of an integrin-binding fragment of vascular cell adhesion molecule-1 at 1.8 angstroms resolution

SCOP Domain Sequences for d1vcaa1:

Sequence; same for both SEQRES and ATOM records:

>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens)}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvyisp

Timeline for d1vcaa1:

• d1vcaa1 first appeared (with stable ids) in SCOP 1.55
  
• d1vcaa1 appears in SCOP 1.69
  
• d1vcaa1 appears in SCOP 1.73
  
• d1vcaa1 appears in the current release, SCOPe 2.08