SCOP 1.65: Domain d1f3je1: 1f3j E:94-191

Lineage for d1f3je1 (1f3j E:94-191)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
probably orthologous to the human HLA-DQ group
Domain d1f3je1: 1f3j E:94-191 [21648]
Other proteins in same PDB: d1f3ja1, d1f3ja2, d1f3jb2, d1f3jd1, d1f3jd2, d1f3je2
complexed with nag

Details for d1f3je1

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7

SCOP Domain Sequences for d1f3je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3je1 b.1.1.2 (E:94-191) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
leqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdw
tfqvlvmlemtphqgevytchvehpslkspitvewraq

SCOP Domain Coordinates for d1f3je1:

Click to download the PDB-style file with coordinates for d1f3je1.
(The format of our PDB-style files is described here.)

Timeline for d1f3je1: