Lineage for d1f3jd1 (1f3j D:83-181)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784786Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 784836Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 784864Domain d1f3jd1: 1f3j D:83-181 [21647]
    Other proteins in same PDB: d1f3ja2, d1f3jb1, d1f3jb2, d1f3jd2, d1f3je1, d1f3je2
    complexed with nag

Details for d1f3jd1

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7
PDB Compounds: (D:) h-2 class II histocompatibility antigen

SCOP Domain Sequences for d1f3jd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3jd1 b.1.1.2 (D:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1f3jd1:

Click to download the PDB-style file with coordinates for d1f3jd1.
(The format of our PDB-style files is described here.)

Timeline for d1f3jd1: