Lineage for d3sknh1 (3skn H:3-126)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033656Domain d3sknh1: 3skn H:3-126 [216454]
    Other proteins in same PDB: d3skna2, d3sknb2, d3sknc2, d3sknd2, d3skne2, d3sknf2, d3skng2, d3sknh2
    automated match to d1ktke1

Details for d3sknh1

PDB Entry: 3skn (more details), 2.9 Å

PDB Description: Crystal structure of the RL42 TCR unliganded
PDB Compounds: (H:) RL42 T cell receptor, beta chain

SCOPe Domain Sequences for d3sknh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sknh1 b.1.1.0 (H:3-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
dgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvle

SCOPe Domain Coordinates for d3sknh1:

Click to download the PDB-style file with coordinates for d3sknh1.
(The format of our PDB-style files is described here.)

Timeline for d3sknh1: