Lineage for d3sknf2 (3skn F:127-255)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517878Domain d3sknf2: 3skn F:127-255 [216451]
    Other proteins in same PDB: d3skna1, d3sknb1, d3sknc1, d3sknd1, d3skne1, d3sknf1, d3skng1, d3sknh1
    automated match to d1ktke2

Details for d3sknf2

PDB Entry: 3skn (more details), 2.9 Å

PDB Description: Crystal structure of the RL42 TCR unliganded
PDB Compounds: (F:) RL42 T cell receptor, beta chain

SCOPe Domain Sequences for d3sknf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sknf2 b.1.1.2 (F:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3sknf2:

Click to download the PDB-style file with coordinates for d3sknf2.
(The format of our PDB-style files is described here.)

Timeline for d3sknf2: