Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d3sknf2: 3skn F:127-255 [216451] Other proteins in same PDB: d3skna1, d3sknb1, d3sknc1, d3sknd1, d3skne1, d3sknf1, d3skng1, d3sknh1 automated match to d1ktke2 |
PDB Entry: 3skn (more details), 2.9 Å
SCOPe Domain Sequences for d3sknf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sknf2 b.1.1.2 (F:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d3sknf2: