Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d1f3ja1: 1f3j A:83-181 [21645] Other proteins in same PDB: d1f3ja2, d1f3jb1, d1f3jb2, d1f3jd2, d1f3je1, d1f3je2 |
PDB Entry: 1f3j (more details), 3.1 Å
SCOP Domain Sequences for d1f3ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ja1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd hsfhklsyltfipsdddiydckvehwgleepvlkhwepe
Timeline for d1f3ja1: