Lineage for d1f3ja1 (1f3j A:83-181)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288947Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 288958Domain d1f3ja1: 1f3j A:83-181 [21645]
    Other proteins in same PDB: d1f3ja2, d1f3jb1, d1f3jb2, d1f3jd2, d1f3je1, d1f3je2

Details for d1f3ja1

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7

SCOP Domain Sequences for d1f3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ja1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOP Domain Coordinates for d1f3ja1:

Click to download the PDB-style file with coordinates for d1f3ja1.
(The format of our PDB-style files is described here.)

Timeline for d1f3ja1: