SCOPe 2.08: Domain d3sknd1: 3skn D:3-126

Lineage for d3sknd1 (3skn D:3-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3sknd1: 3skn D:3-126 [216446]
   Other proteins in same PDB: d3skna2, d3sknb2, d3sknc2, d3sknd2, d3skne2, d3sknf2, d3skng2, d3sknh2
   automated match to d1ktke1

Details for d3sknd1

PDB Entry: 3skn, 2.9 Å

PDB Description: Crystal structure of the RL42 TCR unliganded

PDB Compounds: (D:) RL42 T cell receptor, beta chain

SCOPe Domain Sequences for d3sknd1:

Sequence; same for both SEQRES and ATOM records:

>d3sknd1 b.1.1.0 (D:3-126) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevp
dgynvsrlkkqnfllglesaapsqtsvyfcasgqgnfdiqyfgagtrlsvle

Timeline for d3sknd1:

• d3sknd1 first appeared in SCOPe 2.03
  
• d3sknd1 appears in SCOPe 2.07