Lineage for d3sknc2 (3skn C:125-214)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763468Domain d3sknc2: 3skn C:125-214 [216445]
    Other proteins in same PDB: d3skna1, d3sknb1, d3sknc1, d3sknd1, d3skne1, d3sknf1, d3skng1, d3sknh1
    automated match to d1qrnd2

Details for d3sknc2

PDB Entry: 3skn (more details), 2.9 Å

PDB Description: Crystal structure of the RL42 TCR unliganded
PDB Compounds: (C:) RL42 T cell receptor, alpha chain

SCOPe Domain Sequences for d3sknc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sknc2 b.1.1.2 (C:125-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d3sknc2:

Click to download the PDB-style file with coordinates for d3sknc2.
(The format of our PDB-style files is described here.)

Timeline for d3sknc2: