Lineage for d1es0b1 (1es0 B:94-189)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453132Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 453182Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 453194Domain d1es0b1: 1es0 B:94-189 [21644]
    Other proteins in same PDB: d1es0a1, d1es0a2, d1es0b2
    contains covalently bound peptides

Details for d1es0b1

PDB Entry: 1es0 (more details), 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220
PDB Compounds: (B:)

SCOP Domain Sequences for d1es0b1:

Sequence, based on SEQRES records: (download)

>d1es0b1 b.1.1.2 (B:94-189) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvews

Sequence, based on observed residues (ATOM records): (download)

>d1es0b1 b.1.1.2 (B:94-189) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
rleqpnvaislsntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtphqgevytchvehpslkspitvews

SCOP Domain Coordinates for d1es0b1:

Click to download the PDB-style file with coordinates for d1es0b1.
(The format of our PDB-style files is described here.)

Timeline for d1es0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1es0b2