SCOP 1.67: Domain d1es0b1: 1es0 B:94-189

Lineage for d1es0b1 (1es0 B:94-189)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1es0b1: 1es0 B:94-189 [21644]
   Other proteins in same PDB: d1es0a1, d1es0a2, d1es0b2
   contains covalently bound peptides

Details for d1es0b1

PDB Entry: 1es0, 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220

SCOP Domain Sequences for d1es0b1:

Sequence, based on SEQRES records:

>d1es0b1 b.1.1.2 (B:94-189) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvews

Sequence, based on observed residues (ATOM records):

>d1es0b1 b.1.1.2 (B:94-189) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
rleqpnvaislsntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtphqgevytchvehpslkspitvews

Timeline for d1es0b1:

• d1es0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1es0b1 appears in SCOP 1.65
  
• d1es0b1 appears in SCOP 1.69
  
• d1es0b1 appears in the current release, SCOPe 2.08