![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species) |
![]() | Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries) |
![]() | Domain d1es0b1: 1es0 B:94-189 [21644] Other proteins in same PDB: d1es0a2, d1es0b2 contains covalently bound peptides |
PDB Entry: 1es0 (more details), 2.6 Å
SCOP Domain Sequences for d1es0b1:
Sequence, based on SEQRES records: (download)
>d1es0b1 b.1.1.2 (B:94-189) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)} rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd wtfqvlvmlemtphqgevytchvehpslkspitvews
>d1es0b1 b.1.1.2 (B:94-189) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)} rleqpnvaislsntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm lemtphqgevytchvehpslkspitvews
Timeline for d1es0b1: