| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
| Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries) probably orthologous to the human HLA-DQ group |
| Domain d1es0b1: 1es0 B:94-188 [21644] Other proteins in same PDB: d1es0a1, d1es0a2, d1es0a3, d1es0b2, d1es0b3 contains covalently bound peptides |
PDB Entry: 1es0 (more details), 2.6 Å
SCOPe Domain Sequences for d1es0b1:
Sequence, based on SEQRES records: (download)
>d1es0b1 b.1.1.2 (B:94-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvew
>d1es0b1 b.1.1.2 (B:94-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpnvaislsntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvm
lemtphqgevytchvehpslkspitvew
Timeline for d1es0b1: