Lineage for d1es0a1 (1es0 A:83-180)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159150Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [49141] (2 PDB entries)
  8. 159151Domain d1es0a1: 1es0 A:83-180 [21643]
    Other proteins in same PDB: d1es0a2, d1es0b2

Details for d1es0a1

PDB Entry: 1es0 (more details), 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220
PDB Compounds: (A:)

SCOP Domain Sequences for d1es0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es0a1 b.1.1.2 (A:83-180) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-A(G7)}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwss

SCOP Domain Coordinates for d1es0a1:

Click to download the PDB-style file with coordinates for d1es0a1.
(The format of our PDB-style files is described here.)

Timeline for d1es0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1es0a2