Lineage for d1iaob1 (1iao B:94-188)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288980Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 289019Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 289029Domain d1iaob1: 1iao B:94-188 [21642]
    Other proteins in same PDB: d1iaoa1, d1iaoa2, d1iaob2
    complexed with nag

Details for d1iaob1

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339

SCOP Domain Sequences for d1iaob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaob1 b.1.1.2 (B:94-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvew

SCOP Domain Coordinates for d1iaob1:

Click to download the PDB-style file with coordinates for d1iaob1.
(The format of our PDB-style files is described here.)

Timeline for d1iaob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaob2