Lineage for d1iaob1 (1iao B:94-188)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159166Species Mouse (Mus musculus), I-AD [TaxId:10090] [49140] (2 PDB entries)
  8. 159170Domain d1iaob1: 1iao B:94-188 [21642]
    Other proteins in same PDB: d1iaoa2, d1iaob2

Details for d1iaob1

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339
PDB Compounds: (B:)

SCOP Domain Sequences for d1iaob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaob1 b.1.1.2 (B:94-188) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvew

SCOP Domain Coordinates for d1iaob1:

Click to download the PDB-style file with coordinates for d1iaob1.
(The format of our PDB-style files is described here.)

Timeline for d1iaob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaob2