SCOP 1.69: Domain d1iaoa1: 1iao A:83-178

Lineage for d1iaoa1 (1iao A:83-178)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1iaoa1: 1iao A:83-178 [21641]
   Other proteins in same PDB: d1iaoa2, d1iaob1, d1iaob2

Details for d1iaoa1

PDB Entry: 1iao, 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339

SCOP Domain Sequences for d1iaoa1:

Sequence; same for both SEQRES and ATOM records:

>d1iaoa1 b.1.1.2 (A:83-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhw

Timeline for d1iaoa1:

• d1iaoa1 first appeared (with stable ids) in SCOP 1.55
  
• d1iaoa1 appears in SCOP 1.67
  
• d1iaoa1 appears in SCOP 1.71
  
• d1iaoa1 appears in the current release, SCOPe 2.08