Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries) Uniprot O75015 23-189 |
Domain d3sgkc1: 3sgk C:5-86 [216405] Other proteins in same PDB: d3sgka1, d3sgka2, d3sgkb1, d3sgkb2 automated match to d1fnla1 complexed with mli |
PDB Entry: 3sgk (more details), 2.4 Å
SCOPe Domain Sequences for d3sgkc1:
Sequence, based on SEQRES records: (download)
>d3sgkc1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} lpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvd dsgeyrcqtqlstlsdpvqlev
>d3sgkc1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} lpkavvflepqwyrvlekdsvtlkcqgaqstqwfhneslissqassyfidaatvddsgey rcqtqlstlsdpvqlev
Timeline for d3sgkc1:
View in 3D Domains from other chains: (mouse over for more information) d3sgka1, d3sgka2, d3sgkb1, d3sgkb2 |