Lineage for d3sgka2 (3sgk A:342-444)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748634Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2748637Species Human (Homo sapiens) [TaxId:9606] [88590] (69 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2748688Domain d3sgka2: 3sgk A:342-444 [216402]
    Other proteins in same PDB: d3sgka1, d3sgkb1, d3sgkc1, d3sgkc2
    automated match to d1igyb4
    complexed with mli

Details for d3sgka2

PDB Entry: 3sgk (more details), 2.4 Å

PDB Description: unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
PDB Compounds: (A:) fc fragment

SCOPe Domain Sequences for d3sgka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sgka2 b.1.1.2 (A:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
qprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d3sgka2:

Click to download the PDB-style file with coordinates for d3sgka2.
(The format of our PDB-style files is described here.)

Timeline for d3sgka2: