Lineage for d3sgka1 (3sgk A:236-341)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516071Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1516072Species Human (Homo sapiens) [TaxId:9606] [88585] (35 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1516087Domain d3sgka1: 3sgk A:236-341 [216401]
    Other proteins in same PDB: d3sgka2, d3sgkb2, d3sgkc1, d3sgkc2
    automated match to d1igyb3
    complexed with mli

Details for d3sgka1

PDB Entry: 3sgk (more details), 2.4 Å

PDB Description: unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
PDB Compounds: (A:) fc fragment

SCOPe Domain Sequences for d3sgka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sgka1 b.1.1.2 (A:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d3sgka1:

Click to download the PDB-style file with coordinates for d3sgka1.
(The format of our PDB-style files is described here.)

Timeline for d3sgka1: