SCOP 1.67: Domain d2iadb1: 2iad B:94-190

Lineage for d2iadb1 (2iad B:94-190)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (10 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2iadb1: 2iad B:94-190 [21640]
   Other proteins in same PDB: d2iada1, d2iada2, d2iadb2
   contains covalently bound peptides

Details for d2iadb1

PDB Entry: 2iad, 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138

SCOP Domain Sequences for d2iadb1:

Sequence; same for both SEQRES and ATOM records:

>d2iadb1 b.1.1.2 (B:94-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvewss

Timeline for d2iadb1:

• d2iadb1 first appeared (with stable ids) in SCOP 1.55
  
• d2iadb1 appears in SCOP 1.65
  
• d2iadb1 appears in SCOP 1.69
  
• d2iadb1 appears in the current release, SCOPe 2.08