SCOPe 2.03: Domain d3sgjc1: 3sgj C:6-86

Lineage for d3sgjc1 (3sgj C:6-86)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries)

8. Domain d3sgjc1: 3sgj C:6-86 [216399]
   Other proteins in same PDB: d3sgja1, d3sgja2, d3sgjb1, d3sgjb2
   automated match to d1fnla1
   complexed with mli

Details for d3sgjc1

PDB Entry: 3sgj, 2.2 Å

PDB Description: unique carbohydrate-carbohydrate interactions are required for high affinity binding between fcgiii and antibodies lacking core fucose

PDB Compounds: (C:) human Fcg3a receptor

SCOPe Domain Sequences for d3sgjc1:

Sequence; same for both SEQRES and ATOM records:

>d3sgjc1 b.1.1.4 (C:6-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvdd
sgeyrcqtqlstlsdpvqlev

Timeline for d3sgjc1:

• d3sgjc1 is new in SCOPe 2.03-stable
  
• d3sgjc1 appears in SCOPe 2.04
  
• d3sgjc1 appears in the current release, SCOPe 2.08