SCOPe 2.03: Domain d3sgjb1: 3sgj B:227-341

Lineage for d3sgjb1 (3sgj B:227-341)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (33 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d3sgjb1: 3sgj B:227-341 [216397]
   Other proteins in same PDB: d3sgja2, d3sgjb2, d3sgjc1, d3sgjc2
   automated match to d1igyb3
   complexed with mli

Details for d3sgjb1

PDB Entry: 3sgj, 2.2 Å

PDB Description: unique carbohydrate-carbohydrate interactions are required for high affinity binding between fcgiii and antibodies lacking core fucose

PDB Compounds: (B:) human Fc fragment

SCOPe Domain Sequences for d3sgjb1:

Sequence; same for both SEQRES and ATOM records:

>d3sgjb1 b.1.1.2 (B:227-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhn
aktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Timeline for d3sgjb1:

• d3sgjb1 is new in SCOPe 2.03-stable
  
• d3sgjb1 appears in SCOPe 2.04
  
• d3sgjb1 appears in the current release, SCOPe 2.08