Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d3sgel1: 3sge L:1-112 [216393] Other proteins in same PDB: d3sgeh_, d3sgei2, d3sgej_, d3sgel2 automated match to d1dqdl1 complexed with ca |
PDB Entry: 3sge (more details), 1.89 Å
SCOPe Domain Sequences for d3sgel1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sgel1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgshfpytfgggtkleik
Timeline for d3sgel1:
View in 3D Domains from other chains: (mouse over for more information) d3sgeh_, d3sgei1, d3sgei2, d3sgej_ |