SCOPe 2.05: Domain d2iada1: 2iad A:83-186

Lineage for d2iada1 (2iad A:83-186)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (25 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2iada1: 2iad A:83-186 [21639]
   Other proteins in same PDB: d2iada2, d2iadb1, d2iadb2
   contains covalently bound peptides

Details for d2iada1

PDB Entry: 2iad, 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138

PDB Compounds: (A:) MHC class II I-ad

SCOPe Domain Sequences for d2iada1:

Sequence, based on SEQRES records:

>d2iada1 b.1.1.2 (A:83-186) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepeissadlvpr

Sequence, based on observed residues (ATOM records):

>d2iada1 b.1.1.2 (A:83-186) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwssadlvpr

Timeline for d2iada1:

• d2iada1 first appeared (with stable ids) in SCOP 1.55
  
• d2iada1 appears in SCOPe 2.04
  
• d2iada1 appears in SCOPe 2.06
  
• d2iada1 appears in the current release, SCOPe 2.08