Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries) probably orthologous to the human HLA-DQ group |
Domain d2iada1: 2iad A:83-186 [21639] Other proteins in same PDB: d2iada2, d2iadb1, d2iadb2 contains covalently bound peptides |
PDB Entry: 2iad (more details), 2.4 Å
SCOP Domain Sequences for d2iada1:
Sequence, based on SEQRES records: (download)
>d2iada1 b.1.1.2 (A:83-186) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd hsfhklsyltfipsdddiydckvehwgleepvlkhwepeissadlvpr
>d2iada1 b.1.1.2 (A:83-186) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd hsfhklsyltfipsdddiydckvehwgleepvlkhwssadlvpr
Timeline for d2iada1: