Lineage for d1iebd1 (1ieb D:93-188)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364889Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 364950Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 364966Domain d1iebd1: 1ieb D:93-188 [21638]
    Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb2, d1iebc1, d1iebc2, d1iebd2
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag, so4

Details for d1iebd1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebd1 b.1.1.2 (D:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOP Domain Coordinates for d1iebd1:

Click to download the PDB-style file with coordinates for d1iebd1.
(The format of our PDB-style files is described here.)

Timeline for d1iebd1: