SCOPe 2.03: Domain d1iebc1: 1ieb C:82-182

Lineage for d1iebc1 (1ieb C:82-182)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
probably orthologous to the human HLA-DR group
Domain d1iebc1: 1ieb C:82-182 [21637]
Other proteins in same PDB: d1ieba2, d1iebb1, d1iebb2, d1iebc2, d1iebd1, d1iebd2
complexed with nag, ndg, so4

Details for d1iebc1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

PDB Compounds: (C:) MHC class II I-ek

SCOPe Domain Sequences for d1iebc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOPe Domain Coordinates for d1iebc1:

Click to download the PDB-style file with coordinates for d1iebc1.
(The format of our PDB-style files is described here.)

Timeline for d1iebc1: