Lineage for d1iebc1 (1ieb C:82-182)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453045Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 453111Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 453127Domain d1iebc1: 1ieb C:82-182 [21637]
    Other proteins in same PDB: d1ieba2, d1iebb1, d1iebb2, d1iebc2, d1iebd1, d1iebd2

Details for d1iebc1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOP Domain Coordinates for d1iebc1:

Click to download the PDB-style file with coordinates for d1iebc1.
(The format of our PDB-style files is described here.)

Timeline for d1iebc1: