Lineage for d1iebc1 (1ieb C:82-182)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159086Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 159180Species Mouse (Mus musculus), I-EK [TaxId:10090] [49139] (7 PDB entries)
  8. 159207Domain d1iebc1: 1ieb C:82-182 [21637]
    Other proteins in same PDB: d1ieba2, d1iebb2, d1iebc2, d1iebd2

Details for d1iebc1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebc1 b.1.1.2 (C:82-182) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-EK}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOP Domain Coordinates for d1iebc1:

Click to download the PDB-style file with coordinates for d1iebc1.
(The format of our PDB-style files is described here.)

Timeline for d1iebc1: