Lineage for d3se8l2 (3se8 L:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1762881Domain d3se8l2: 3se8 L:108-213 [216360]
    Other proteins in same PDB: d3se8l1
    automated match to d1rhha2
    complexed with edo, nag, so4, trs

Details for d3se8l2

PDB Entry: 3se8 (more details), 1.9 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc03 in complex with hiv-1 gp120
PDB Compounds: (L:) Light chain of antibody VRC03

SCOPe Domain Sequences for d3se8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3se8l2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3se8l2:

Click to download the PDB-style file with coordinates for d3se8l2.
(The format of our PDB-style files is described here.)

Timeline for d3se8l2: