Lineage for d1iebb1 (1ieb B:93-188)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292026Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1292125Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 1292142Domain d1iebb1: 1ieb B:93-188 [21636]
    Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb2, d1iebc1, d1iebc2, d1iebd2
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag, ndg, so4

Details for d1iebb1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen
PDB Compounds: (B:) MHC class II I-ek

SCOPe Domain Sequences for d1iebb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebb1 b.1.1.2 (B:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOPe Domain Coordinates for d1iebb1:

Click to download the PDB-style file with coordinates for d1iebb1.
(The format of our PDB-style files is described here.)

Timeline for d1iebb1: