SCOPe 2.04: Domain d3sdyl1: 3sdy L:1-107

Lineage for d3sdyl1 (3sdy L:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d3sdyl1: 3sdy L:1-107 [216357]
   Other proteins in same PDB: d3sdya_, d3sdyb_, d3sdyl2
   automated match to d1rhha1
   complexed with so4

Details for d3sdyl1

PDB Entry: 3sdy, 2.85 Å

PDB Description: crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin

PDB Compounds: (L:) Antibody CR8020, Light Chain

SCOPe Domain Sequences for d3sdyl1:

Sequence; same for both SEQRES and ATOM records:

>d3sdyl1 b.1.1.1 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivmtqspgtlslspgeratlscrasqsvsmnylawfqqkpgqaprlliygasrratgip
drisgsgsgtdftltisrlepadfavyycqqygtsprtfgqgakveik

Timeline for d3sdyl1:

• d3sdyl1 first appeared in SCOPe 2.03
  
• d3sdyl1 appears in SCOPe 2.05
  
• d3sdyl1 appears in the current release, SCOPe 2.08