Lineage for d3sdya_ (3sdy A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531384Domain d3sdya_: 3sdy A: [216356]
    Other proteins in same PDB: d3sdyb_, d3sdyl1, d3sdyl2
    automated match to d2viua_
    complexed with so4

Details for d3sdya_

PDB Entry: 3sdy (more details), 2.85 Å

PDB Description: crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3sdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdya_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpekq

SCOPe Domain Coordinates for d3sdya_:

Click to download the PDB-style file with coordinates for d3sdya_.
(The format of our PDB-style files is described here.)

Timeline for d3sdya_: